TCDB is operated by the Saier Lab Bioinformatics Group
>RVE59394.1 hypothetical protein OJAV_G00188100 [Oryzias javanicus]
MERDKVEGVLLREGDWRMFLSLLWLRQASLRSILRKPVLRHSRVCTCSLAGPSPCSKCSNTQSPRCSKSPKTHLEGWKHT
CKCGNFSAWGFPAHPETDL