TCDB is operated by the Saier Lab Bioinformatics Group
>tr|S0ESS8|S0ESS8_9BACT Uncharacterized protein OS=Chthonomonas calidirosea T49 GN=CCALI_00582 PE=4 SV=1
MLVVCKTWHSVCRLLFICGFLLSLTLRVAFAGPPFITDDPEPVEWHHWEVYISSIYEHTKDGTSGTLPHVEINNGIVPNV
QLHLILPMAFSQATGGPLLYGFGDIELGVKYRFVQEGRRRPMVGIFPLLEVPTGDANRGLGSGHLQTFLPIWLQKSWRTW
TTYGGGGYWINPGAGNHNYLYLGWLLQKDLNSHLTLGGEVYYNTSPAVGESETMGFNFGGQYNFDDGHHLLFSFGRTFSG
DTSFMSYIGFQWTFGPHETSEQEAQ