TCDB is operated by the Saier Lab Bioinformatics Group
>tr|S4XU18|S4XU18_SORCE Uncharacterized protein OS=Sorangium cellulosum So0157-2 GN=SCE1572_20740 PE=4 SV=1
MRRLLLPLLALAGLLAERPALAEEGRFDAQVFRPAAAPRDLVMVQKSEVIGNLSPTVGLYSDIAADPLVLFLAGDDTNKA
VNAITGRLELALLAGIGFFDVFDVTMTMPLILFQEGGNLRRFGTEGSVKSTTVGDLRLSTKVSLPYLNRKEQVKEGFGMA
IAGNLNFPTGDQNAFASDGAMSGGATLIADYRFNFGLLLAANAGIWLRPDNQFAGVRVGDMAQFGVAAEQYVVQRWGLSV
IGEVYGYPSMTSYPDDPGQIPAEALLGLRWQTKHGITITFGGSFGAACGFGAPAIRFFNVITWQPKTSQEQEEINRLQQR
DNDDPDRDGLIGAADRCPDVPGSPENFGCPDLDTDGDGIFDRDDKCPDKPAGPHGKDGCPLAFVRGDEIVITEQVHFATD
RDIILEDSNPTLEAVAQVLIDNPEIREVRIEGHTDVRATDVYNLALSQRRVASVMAYLIAKGVDPSRLQAKGYGHTQPIY
DDAGCVGPDDQLTPDCQFMTSKNRRVVFRILRYGNAAPKPLTGSPEGSEQILPSGGVLPQKSQGTLPTQGTLPGQGVLKP
NVLPSGGSALPSAGGVPGGAAPLPNRGEAGGLPSKSGVLPRSGSTTPPAPSSSAQPPAPPQKPAPAPR