TCDB is operated by the Saier Lab Bioinformatics Group
>tr|S5XTE7|S5XTE7_CORGT Citrate uptake transporter, substrate binding protein OS=Corynebacterium glutamicum MB001 GN=tctC PE=4 SV=1
MAEVGAEPAGSAQSKTKQFVVGTAAVVITAIAAFFSIQSASGGEDIRSNMTLIAPAAAGGGWDTFQREQQQSMRVNKIVN
NIQVVNIPGAGGTIALGKLSTMTAPNTLMVGGTGHIAAQIQFDTPAKIQDVTPIARVVEEFDIITVPADSPYNTLEELIE
GWKADPAGVSWTGGGSFDQLVMTEIALSAGIDPKQTTFIPSDGGGEAIQALLNGTAKASTGGFADMYPQVEAGRLKVLGI
AAEERLPGSDIPTLVEQGYDVTLTNWRAMFAPPGLSDDQIAELRAIVAESVETAEWQSAVERNYWMNASLEGEELDQFVE
DEIDRIDQLFKEMG