TCDB is operated by the Saier Lab Bioinformatics Group
>tr|T2KLL7|T2KLL7_9FLAO Conserved hypothetical membrane protein (DUF1275) OS=Formosa agariphila KMM 3901 GN=BN863_11770 PE=4 SV=1
MFRHQGKSRTLKHNLRIATILSFVAGIVNVSGFLAFHQLTTNVTGHFALFISDVANFDFWIGTIYFLYIFSFLLGSFVSS
FLIEKFKANKKLNVFVLPTLIECFILISIAIISNTTQIKYPDFIVCLLLFAMGLQNSFVTKISNAVVRTTHLTGLFTDLG
IEFSQLLFPESHPNREKIKATIKLRIFIICFFFLGGLIGGFLYSRLNLKLNSLIFGALILLVSLSFDDLRYKLIRTKRKY
KQRQITLHKNV