TCDB is operated by the Saier Lab Bioinformatics Group
>TGO16390.1 hypothetical protein BTUL_0029g00810 [Botrytis tulipae]
MSGRGAWRPMNPKNITVRAAVWIIGAIPFFTFSAMSIAGSATTTPGMQNVFIGQISKVGSDGSKIGGLRFGYMGICAYVG
VEGSNGDTFKNTNGFQCIGKQYSQSPDEIAATLHVDSNIIQLGQKLQNDISIFMPMVALSLFLLGFLVDTGAWLLAGLGK
PAGKIGMVAMPFLWASVATSLGAAYTLTVSVNAINTVLGDTAVGCSANVQIEQGKTLEGLQWAAFAFALLFSFGIYMVTR
DTMYGFNIAPRARSRGRRMNDAYPDEYSEEERSLSYER