TCDB is operated by the Saier Lab Bioinformatics Group
>TSC84565.1 hypothetical protein G01um101417_96 [Parcubacteria group bacterium Gr01-1014_17]
MFESIYVSILIAGFGGGAVRGLVGFIKHQYSYKSVPFKLPYFLGMMFISGIVGVLSAMTIKELGLTFFGLPQLTPALAFV
IGYAGGDFLENVYKTIIKKPSLYSFPGDLIKK