TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W7X390|W7X390_TETTS Transmembrane protein, putative OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_000290919 PE=4 SV=1
MSQRNIQVAYDHSPQRQKRITQFVNKGNKVRRNREQDRHEKRNRKEESESSSQSSSKSSSRSSSQKSSSSSGEEENNKNK
RQSRRDIQKATQARKSVYLQQEKLRELQQREKQEKTKIMIMKSQKKIDMQENKIEDLQQELEYQKQNVDQLNKERQKLKQ
ETQKIQMIEQQKNLVQSNYEAHKLKVETVKKNFMKRQQTQVDIKADNFNKALHNDQSKVREVGNTILFIFNQLFFALSNN
YFLSKYVYQIANSYGAKSEVFFSKNAFLFNNYLFSVLIFIPFYVEYFINTKISGIDSFFLHNYAYSTHSYVSVSLAIFFL
FQLIVGIYKYNDIKKKEVGQEAKKSKKIINFRIVFGDWNWKIRERDSIQKNQISLTKRVLQYYSDKDSHYKKYMDQNAGL
IQKLIFRFLIVGLIISSIVPVIIIHQKDIFFDLVDIKFISEIINGLIIACISKMVYMIIIPLNKFEGLANQDSRTKLLYL
KKFFSEIFPILASILMSYSVILENDTYIFYIGILTNNISYDYTKYVCRESQVAYQLFGLLIGHFIISIVFQYIPSILNSI
MKSGSKSKFEQSIQFDTIDASISLLVSNTIFLALLPFSFFSIFAFLVILLLNFLNEWLIQQKITLPQFSGLSSTHLKGFV
SFFYNTTLLFCFCYYSFFFVRTFTPIYHFDNNTMYCNPFMGQTTSLANRFRQYLYDTQVIGVAYDILTWLPLIYGLFIIY
LVAYLVSQNQKRVWEFEFQKKLKELSGIKQYYESRINRLEKRIDDANKILEEDAFLTQENDDYNINNGTTNIPHSRIPQK
PQLSSTLAFLDQEDQNIRQGSETSIKLHSLSKMNRFGNPSQSHIAPTASSKLLNQYLTTDGKDADASSKENINQDLNLKK
NNLGRPKNFF