TCDB is operated by the Saier Lab Bioinformatics Group
>WP_003643800.1 hypothetical protein [Lactobacillus plantarum]
MDKFEKISTSNLEKISGGDLTTKLWSSWGYYLGKKARWNLKHPYVQF