TCDB is operated by the Saier Lab Bioinformatics Group
>WP_010891778.1 UPF0104 family protein [Ureaplasma parvum]
MDNNINEKTSFWTKKNICFLIIGLIVCLLMIIISILFILDIDFQNLFIKINHSLKTIKLAILWLLILISFIFFRAFMFIV
IAVIDTYKNQIKIAWWKWILYSFSLIFLNAVTPFSVGSEPFSIYFLNKNGYHNLKKVSALLLVSSTFYELGQVIVTVPSF
IYINYELITYAVNNKTSLPFYYYLAVVGIIADLCMTAIYFVLGFSKKLHFRSVLIYNWVKKLFKLKYLTKIELIQKNNQN
ISFKAFYLYYFKTLRVSLLAFVIGVVYNIGIYALMYISYRLVEPKPHNIFFDLFNYTNIAVTATNFVPLPGSEGSIQFML
RVFLTNDQNQIRYAMNWLSTQDINNIIFIWRMFSIYLGSLIGMFGFGYFLIFDLYKFIKKAKVDKKR