TCDB is operated by the Saier Lab Bioinformatics Group
>WP_028915076.1 MULTISPECIES: hypothetical protein [Pseudoxanthomonas]
MRELQELEVASVSGSGEGGAAIGGIVGGIAGRYGGVTAGAAIGGAIGSVIPGVGTVAGGLIGATVGLIHGSLIGGAVGGY
AGSKIQDALMQK