TCDB is operated by the Saier Lab Bioinformatics Group
>WP_029308869.1 DUF1275 domain-containing protein [Cupriavidus metallidurans]
MPIGFLRSLTARHRNPVSNRRLARVLCFVAGAANAGGFLAVQQYTSHMSGVVSAIADDLVLQRYGLVVHGIGALASFLAG
AGTTAILVNWARRARLRSEYAIPLLVEATLLLCFGLLGSHLNDMDWLFVPATVMLLCFMMGLQNALITKLSNAEIRTTHV
TGMVTDIGIELGKLFYWNAAVRPNSRPVMADRHKLRLLTVLVGMFLVGGIVGAQAFSTLGYAATLPLAALLLIVAIIPVA
DDLLTRLLLRVHRADSARRARRWGARGR