TCDB is operated by the Saier Lab Bioinformatics Group
>WP_055414402.1 hypothetical protein [Acinetobacter soli]
MPEPTASSSAGFGLATNLTGGSIAVLGGFTTTEWMAIVGGLCAVIGLLIQAWSTIRKDQRDQQLHNKKMKNKGCCDDE