TCDB is operated by the Saier Lab Bioinformatics Group
>WP_077419983.1 lysis protein [Rodentibacter trehalosifermentans]
MKDIQSNAPYVSGGFTAFMGVISNMFSNVTLADVGVIVGIIVTIATWVVNWYYKKKDFELRKLEIEGKLNDKKKR