TCDB is operated by the Saier Lab Bioinformatics Group
>WP_081460202.1 flippase-like domain-containing protein [Anaerolinea thermophila]
MLPRKFLDFDPSNDAQVGFFSSNLCFVLSQKEFNIIIGDVKKFLIALVLLLGILFIIGRAAEMQDIGKVLQRGDFGWIAL
AIVLLGGWFFNLGLTYQAIYAILDMPVSALHMTRVATAVNFINIVAPSAGLGSVAIFMSDAASNNRSTGKTAIAAVMFVL
LEYVAVLFVLVFGLAELAYRNNLHWAEVIASLILLIGALGLAILLYIGMQSASLFARVLQWGARTVNRLLKPFIKKEYLS
EERAHEFAFEAAEGIAIVRHHPQRIIRPILLALLNKVILIGILTLTFLAFHVPFTPGVVIAGFSLASLFLIVSPTPAGIG
IVEGVLTVALRSLQVPIEDAAVITMAYRGITFWVPLLVGMVTFRTLPHHQ