TCDB is operated by the Saier Lab Bioinformatics Group
>WP_097540830.1 phage holin family protein [Enterobacter cloacae]
MYRMDKIREWFSYWFGGLTAMGGVLSLNDWALIVGILCTIGTFGINWYYKRKEREDRLNGNVTGTQK