TCDB is operated by the Saier Lab Bioinformatics Group
>WP_111639978.1 phage holin family protein [Marinomonas shanghaiensis]
MMWPKWQGLGRVRAPLVSKLALYDFLEPRIRGAFLFLKGHFMKFLPDELLQTAAFVLVGVLGGAVKYLRDFQQNAKKFSL
IHMLIAVFTGGFLGMLTFFLCTSMNMPPAATGFMSGVAGLMGDEAIKLFINRFKRSLS