TCDB is operated by the Saier Lab Bioinformatics Group
>WP_111943829.1 clostridolysin BstA family TOMM peptide [Clostridiaceae bacterium 14S0207]
MLKFEKNVLATSAKKENVQLAPGGCCCCCCCCCVSVGVNGGTATSTVPTPGK