TCDB is operated by the Saier Lab Bioinformatics Group
>WP_116718986.1 two pore domain potassium channel family protein [Anaerolineales bacterium]
MMFFVLIIRFFRSIRQGLQDREFRALFIWVVLVIAGGTLFYARVEHWRILDALYFTIITLATVGYGDFAPKTDAGKIFTM
VYIFVGISLISGFIILLGEHSRKVKPLVGRKLKEDDIESTES