TCDB is operated by the Saier Lab Bioinformatics Group
>WP_216200341.1 polysaccharide biosynthesis protein [Clostridium algidicarnis]
MRNLKKIALVITDVFSVNVAYIIAFSLIYYGIPRLYFDSFKKDAIIISLIYIVVFYIMKLYESLWNYASIDELMLVVTAN
IISGCLVMGYGRSIGHYFPINIHIIAIVLAMALTLSFRLSFRIYRRGIVSVYIRHNRNRNRVMVIGAGSAGNMIMKEMLT
KREKRYNPIAIIDDSPYKIGKRICGVKVMGNRQDIERIAKEERIDTILIAIPSINQKDKSEIINICKKTACKLQIIPGLY
EILNGQAKLNTMRDVSVEDLLGRDQINLDSKGISEYIHNKVVMVTGGGGSIGSELCRQIAIFNPKELIIFDIYENNAYDI
QNELKYNYPSLNLKVLIGSIRDKKRLETIFCKYRPEIVFNAAAHKHVPLMEESPGEAIKNNVFGTLNLAETADKYGVKRF
VMISTDKAVNPTNVMGASKRICEMIVQAMDKVSKTEFVAVRFGNVLGSNGSVIPLFKKQIAKGGPVTLTHKDITRFFMLI
PEAAQLVIQAGAYAKGGEIFVLDMGSPIKIYDLATDLIKLSGLVPNEDIEIKVTGLRPGEKLYEELLMSEEGLEETRHDK
IFIGRPTYTNIEELKRNLNSLKFIIDNDNEEEIKNGIKQMVPTYREASLKEQKRQSKDVGYKDNKIHEKGIVEEEVAAGV