TCDB is operated by the Saier Lab Bioinformatics Group
>XP_005714198.1 unnamed protein product [Chondrus crispus]
MRKYRPRLSASMLRTYNPTHSSPTWTESDAKPPSKTESTVTLHEIPKGQTFKENNWQSPSFILWMAMLAKEAFRYIQYQK
ISFVVASLSVFLVVFAATMLSSLSSYASIVITRLAELQVGESDVLVSSRSAADFLNFTAMKHTIEETTDTISKEGLNVNK
SLSPRLGFRVSVQALVCKQEPTSRGTCRENHNYTGEVVPARLILYDHDIEREAQIGKLWPHPKLQTGHVYMKAGLQQRLR
ISEGDYVRLSVHIGMFLSQVFRRSVNANDSVVVVPVRIRKTVESLHGKFPVISSTEDEDEEVAGVFGELSHFLRDAVAFA
NLSSPDAEKLQEHRLQDTVSTMLIRIPKQRASVYYNSDFAMMQRQVVHFATAVLRDMSLDSLKVSLPLLKKLDEYKFLSL
FIGLVIQVVIFVFAFLCFILLYSHMFFAVESRSTEMGTLRLLGLTRGGVAWMTLMEMLIIAIPSWGLALLAAQFSFRTLA
IVANERFGTNLPELISTSSIVMACAVGLALPVLASLLPVRKAMTRRPLDAFSWRTSRISAVVISKQKNDGLASPGLMIAA
SLMTLYGIIIFNIFPKAIIKMDLKSLVYLFEVFIISILFGMVLFLTNFDLQTSVALKKALFFYERQSVRRISRLNLITHR
RRNRRTFLMYSISVALVVYIETSLQLQLETVLTIMRFHTGATYRVSPRISGDSKAFECCKQKLEELSSSPGVKSFTWVSE
SIPKFLPKDASMTNLGGAFSTPLHAQAVLPSYLGSTYKGIYRGSLKSRGSWNNVDVYEELYTIKGSQSIVVHDGMRRVLG
LRGPGSPVAARVVYTRNDAPDSTAEIQTGPKTVKEGSSILSVSAEFSGLPGFHKNKYSKYQPSLVSFPTFTRLIGGRYPY
VDKLPLRVFLLHVDTNSVTSSNLADIGQTLGKIKGPRLDVESVEETTESIAAASTIMRFGFLGINALVQTVCFFALLAGM
IANARESRKETAVLRAIGIREHVLIRIVLAEALSLLMGASAVGIATGWGVSHVQHYQQNIFLDLNSTIHVPWITFATTFV
VSLVSSIISAVLSSRLGRRSITTDLSKV