TCDB is operated by the Saier Lab Bioinformatics Group
>XP_009312686.1 putative ATP-binding cassette protein [Trypanosoma grayi]
MSIQRENDAVECVQPLLYDSHAHAQPANAASIDLVEFEIERPVDVTLTFKDVAYYVNDGKSAVKNILRGVSGYVRSGQLL
AVLGPSGAGKSTLLDIIAQRPKSGTVSGSIMLNGREIQQSVFRRISGYVQQEDLLQSYLTVRESIFYAAELRTPPTLTRE
VLMSRTQHIMRMLGIEGVQDMKIGSEVMRGISGGEKKRCAIAMELVATPSLLFLDELTTGLDTFTALHLLTILKDLAEAG
VAVVFSIHQPRSSIFHLFDQVLLLNGGGEQAYFGPAGEAMPFLARIGIEPYLPENPADFLLDTVAVLSTEAVRGDDWMQR
HKITPVQNGATVAESFRRLLSHTVKHEIDTLNDAYGKSAAGIPLSVSSPYYRSVLTQIRVVSTRAVLNKLRDPIATLAAV
VAAIFFAVLIGSVYFRVGLAAPSIRNRMGVLFFVVMNTAFSSLGSLGVLMVDRAIFVREHSNGMYRAIAYYIGKIVQDVP
ISVLTNLIFNSIVYFMVGLQPRADKFFLFYLACTLTMLNSYALCLFISSLSKNMQVANIXPAPSPC