TCDB is operated by the Saier Lab Bioinformatics Group
>YP_009174599.1 hypothetical protein [Yellowstone lake phycodnavirus 2]
MFHNFFKLLVALIVTNLSFAGVMHSWVTDSDMSGLRKGSTDRFVDLLYFSIVSFSTTGYGDIAPKSTRAKMAVCLFLMFV
NIAAIYGIYNALVTSA