| Transporter Information: | |
| Name: | ATPase, H+ transporting, lysosomal V0 subunit a isoform 1 |
|---|---|
| Symbol: | ATP6V0A1 |
| TC: | 3.A.2.2.3 |
| Locations: | 17q21 |
| Aliases: | a1, Vph1, Stv1 |
| GenBank: | U73006 |
| Swiss-Prot: | Q93050 |
| Accession Number: | NM_005177 |
| Old Name: | ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 1A (110/116kD) |
| GDB | GDB:125314 |
| LocusLink | 535 |
| OMIM | 192130 |
| PubMed (7774924): | Brody LC, Abel KJ, Castilla LH, Couch FJ, McKinley DR, Yin G, Ho PP,Merajver S, Chandrasekharappa SC, Xu J, et al. Construction of a transcription map surrounding the BRCA1 locus of humanchromosome 17.Genomics. 1995 Jan 1;25(1):238-47. PMID: 7774924 [PubMed - indexed for MEDLINE] We have used a combination of methods (exon amplification, direct selection, direct screening, evolutionary conservation, island rescue-PCR, and direct sequence analysis) to survey approximately 600 kb of genomic DNA surrounding the BRCA1 gene for transcribed sequences. We have cloned a set of fragments representing at least 26 genes. The DNA sequence of these clones reveals that 5 are previously cloned genes; the precise chromosomal location of 2 was previously unknown, and 3 have been cloned and mapped by others to this interval. Three other genes, including BRCA1 itself, have recently been mapped independently to this region. Sequences from 11 genes are similar but not identical matches to known genes; 5 of these appear to be the human homologues of genes cloned from other species. Another 7 genes have no similarity with known genes. In addition, 39 putative exons and 14 expressed sequence tags have been identified and mapped to individual cosmids. This transcript map provides a detailed description of gene organization for this region of the genome. |
>Q93050|VPP1_HUMAN Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1 - Homo sapiens (Human).
MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIM
DTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPSEM
GRGTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGF
RASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLNLCNIDVTQKCLI
AEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQTPPTYNKTNKFTYGFQNIVDAYGIGTYREINPAPYTIITFP
FLFAVMFGDFGHGILMTLFAVWMVLRESRILSQKNENEMFSTVFSGRYIILLMGVFSMYTGLIYNDCFSKSLNIFGSSWS
VRPMFTYNWTEETLRGNPVLQLNPALPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKMSVILGIIHMLFGVSLSLFNHI
YFKKPLNIYFGFIPEIIFMTSLFGYLVILIFYKWTAYDAHTSENAPSLLIHFINMFLFSYPESGYSMLYSGQKGIQCFLV
VVALLCVPWMLLFKPLVLRRQYLRRKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDADEPSEDEVFDFGDTMVHQ
AIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLSVKSLAGGLVLFFFFTAFATLTVAILLIMEGLSAFL
HALRLHWVEFQNKFYSGTGFKFLPFSFEHIREGKFEE
| |