Electrical excitability of neurons and muscle cells is mediated largely through the actions of the voltage-gated sodium channel. Initiation and propagation of the action potential is a direct result of the precisely controlled inward flux of sodium through these channels. Much attention has been paid to the sodium channel alpha-subunit, the major, pore-forming component. However, alpha-subunits are associated with one or more smaller beta-subunits, which have been implicated in the critical fine tuning of the gating properties of the channel. To investigate the properties of the beta-subunit, we have isolated a cDNA encoding the human brain beta 1-subunit and assigned the corresponding gene to chromosome 19. We have also examined the effects of expressing the brain beta 1-subunit on the kinetics of a coexpressed muscle sodium channel alpha-subunit. Our results underscore the functional importance of the beta 1-subunit and imply a conserved mechanism for the interaction of the beta 1-subunit with different alpha-subunits.

>sp|Q07699|SCN1B_HUMAN Sodium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=SCN1B PE=1 SV=1
MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVLQL
EEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSE
IMMYVLIVVLTIWLVAEMIYCYKKIAAATETAAQENASEYLAITSESKENCTGVQVAE