Transporter Information: | |
Name: | solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19 |
---|---|
Symbol: | SLC25A19 |
TC: | 2.A.29.16.1 |
Locations: | 17q25 |
Aliases: | DNC, MUP1 |
Swiss-Prot: | Q9HC21 |
Accession Number: | NM_021734 |
GDB | GDB:11504439 |
LocusLink | 60386 |
OMIM | 606521 |
PubMed (11474176): | Iacobazzi V, Ventura M, Fiermonte G, Prezioso G, Rocchi M, Palmieri F. Genomic organization and mapping of the gene (SLC25A19) encoding the humanmitochondrial deoxynucleotide carrier (DNC).Cytogenet Cell Genet. 2001;93(1-2):40-2. PMID: 11474176 [PubMed - indexed for MEDLINE] The deoxynucleotide carrier (DNC) transports deoxynucleotides into mitochondria and is therefore essential for mtDNA synthesis. The human DNC gene (SLC25A19) spans about 16.5 kb and consists of nine exons with the translation start site in exon 4. It is located on chromosome 17q25.3. Three transcripts, which differ in their 5' ends and are generated by alternative splicing, have been identified. |
PubMed (11226231): | Dolce V, Fiermonte G, Runswick MJ, Palmieri F, Walker JE. The human mitochondrial deoxynucleotide carrier and its role in the toxicity ofnucleoside antivirals.Proc Natl Acad Sci U S A. 2001 Feb 27;98(5):2284-8. Epub 2001 Feb 20. PMID: 11226231 [PubMed - indexed for MEDLINE] The synthesis of DNA in mitochondria requires the uptake of deoxynucleotides into the matrix of the organelle. We have characterized a human cDNA encoding a member of the family of mitochondrial carriers. The protein has been overexpressed in bacteria and reconstituted into phospholipid vesicles where it catalyzed the transport of all four deoxy (d) NDPs, and, less efficiently, the corresponding dNTPs, in exchange for dNDPs, ADP, or ATP. It did not transport dNMPs, NMPs, deoxynucleosides, nucleosides, purines, or pyrimidines. The physiological role of this deoxynucleotide carrier is probably to supply deoxynucleotides to the mitochondrial matrix for conversion to triphosphates and incorporation into mitochondrial DNA. The protein is expressed in all human tissues that were examined except for placenta, in accord with such a central role. The deoxynucleotide carrier also transports dideoxynucleotides efficiently. It is likely to be medically important by providing the means of uptake into mitochondria of nucleoside analogs, leading to the mitochondrial impairment that underlies the toxic side effects of such drugs in the treatment of viral illnesses, including AIDS, and in cancer therapy. |
>tr|Q9HC21 MITOCHONDRIAL UNCOUPLING PROTEIN 1 (DEOXYNUCLEOTIDE CARRIER) - Homo sapiens (Human). MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWK GHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRH AVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLF KKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR |